Collagen, Type VI (COL6) Antikörper

Details zu Produkt Nr. ABIN4264438, Anbieter: Anmelden zum Anzeigen
  • CBR
  • SDR21C1
  • hCBR1
  • carbonyl reductase 1
  • CBR1
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to COL6A1(collagen, type VI, alpha 1) The peptide sequence was selected from the middle region of COL6A1 (NP_001839). Peptide sequence ADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQ.
Reinigung Immunogen affinity purified
Andere Bezeichnung Collagen VI (COL6 Antibody Abstract)
Hintergrund Gene Symbol: COL6A1
Molekulargewicht Theoretical MW: 108 kDa
Gen-ID 1291
UniProt P12109
Forschungsgebiet Extracellular Matrix, Cancer
Applikationshinweise Western Blot 0.2-1 μg/mLThis is a rabbit polyclonal antibody against COL6A1 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?