Collagen, Type VI (COL6) Antikörper

Details zu Produkt Nr. ABIN4264437, Anbieter: Anmelden zum Anzeigen
Antigen
Reaktivität
Human
77
24
17
9
7
3
3
2
1
1
Wirt
Kaninchen
56
18
3
2
1
Klonalität
Polyklonal
Konjugat
Unkonjugiert
15
1
1
Applikation
Immunofluorescence (IF), Western Blotting (WB)
62
55
36
35
33
25
23
16
14
5
4
3
3
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CBR1(carbonyl reductase 1) The peptide sequence was selected form the middle region of CBR1. Peptide sequence AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ.
Reinigung Immunogen affinity purified
Andere Bezeichnung Collagen VI
Hintergrund Gene Symbol: CBR1
Gen-ID 873
UniProt P16152
Forschungsgebiet Metabolism
Applikationshinweise Western Blot, ImmunofluorescenceThis is a rabbit polyclonal antibody against CBR1 and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?