Collagen, Type VI (COL6) Antikörper

Details zu Produkt Nr. ABIN4264437, Anbieter: Anmelden zum Anzeigen
Immunofluorescence (IF), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to CBR1(carbonyl reductase 1) The peptide sequence was selected form the middle region of CBR1. Peptide sequence AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ.
Reinigung Immunogen affinity purified
Andere Bezeichnung Collagen VI
Hintergrund Gene Symbol: CBR1
Gen-ID 873
UniProt P16152
Forschungsgebiet Metabolism
Applikationshinweise Western Blot, ImmunofluorescenceThis is a rabbit polyclonal antibody against CBR1 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.