COL9A3 Antikörper (Collagen, Type IX, alpha 3) (C-Term)

Details for Product anti-COL9A3 Antibody No. ABIN4264327, Anbieter: Anmelden zum Anzeigen
  • col9a3
  • MGC80136
  • cb367
  • sb:cb367
  • wu:fa04f01
  • si:ch73-162j3.1
  • COL9A3
  • LOC100221007
  • LOC100225204
  • AV006866
  • DJ885L7.4.1
  • EDM3
  • IDD
  • MED
  • collagen, type IX, alpha 3
  • col9a3
  • COL9A3
  • LOC100221007
  • LOC100225204
  • Col9a3
Dieser COL9A3 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to COL9A3 (collagen, type IX, alpha 3) The peptide sequence was selected from the C terminal of COL9A3. Peptide sequence PGITGKPGVPGKEASEQRIRELCGGMISEQIAQLAAHLRKPLAPGSIGRP.
Reinigung Immunogen affinity purified
Andere Bezeichnung COL9A3 (COL9A3 Antibody Abstract)
Hintergrund Gene Symbol: COL9A3
Molekulargewicht Theoretical MW: 63 kDa
Gen-ID 1299
UniProt Q14050
Forschungsgebiet Signaling, Extracellular Matrix
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against COL9A3 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.