COL8a2 Antikörper (Collagen, Type VIII, alpha 2)

Details for Product anti-COL8a2 Antibody No. ABIN4264324, Anbieter: Anmelden zum Anzeigen
Antigen
  • FECD
  • FECD1
  • PPCD
  • PPCD2
  • AI429819
  • collagen, type VIII, alpha 2
  • COL8A2
  • Col8a2
Reaktivität
Human
41
10
5
4
3
3
2
2
1
1
1
Wirt
Kaninchen
44
3
Klonalität
Polyklonal
Konjugat
Dieser COL8a2 Antikörper ist unkonjugiert
6
4
2
2
2
2
Applikation
Western Blotting (WB)
45
28
22
18
6
3
3
2
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptide directed towards the middle region of human COL8A2The immunogen for this antibody is COL8A2. Peptide sequence AAGLPGPQGPSGAKGEPGTRGPPGLIGPTGYGMPGLPGPKGDRGPAGVPG.
Reinigung Immunogen affinity purified
Andere Bezeichnung COL8A2 (COL8a2 Antibody Abstract)
Hintergrund Gene Symbol: COL8A2
Molekulargewicht Theoretical MW: 67 kDa
Gen-ID 1296
NCBI Accession NP_005193
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against COL8A2 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.