Coagulation Factor C Homolog, Cochlin (Limulus Polyphemus) (COCH) (C-Term) Antikörper

Details zu Produkt Nr. ABIN4264306, Anbieter: Anmelden zum Anzeigen
  • AW122937
  • Coch-5B2
  • D12H14S564E
  • COCH-5B2
  • COCH5B2
  • DFNA9
  • cochlin
  • coagulation factor C homolog (Limulus polyphemus)
  • coagulation factor C homolog, cochlin (Limulus polyphemus)
  • Coch
  • COCH
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to COCH (coagulation factor C homolog, cochlin (Limulus polyphemus)) The peptide sequence was selected from the C terminal of COCH. Peptide sequence VAWAPLDDLKDMASKPKESHAFFTREFTGLEPIVSDVIRGICRDFLESQQ.
Reinigung Immunogen affinity purified
Andere Bezeichnung Cochlin (COCH Antibody Abstract)
Hintergrund Gene Symbol: COCH
Molekulargewicht Theoretical MW: 57 kDa
Gen-ID 1690
UniProt O43405
Pathways Sensory Perception of Sound
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against COCH and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?