Coagulation Factor XIV/Protein C (N-Term) Antikörper

Details zu Produkt Nr. ABIN4264276, Anbieter: Anmelden zum Anzeigen
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to PROC(protein C (inactivator of coagulation factors Va and VIIIa)) The peptide sequence was selected from the N terminal of PROC. Peptide sequence MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEEL.
Reinigung Protein A purified
Hintergrund Gene Symbol: PROC
Gen-ID 5624
UniProt P04070
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against PROC and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-Coagulation Factor XIV/Protein C (N-Term) antibody (ABIN4264276) Western Blot: Coagulation Factor XIV/Protein C Antibody [NBP1-58065] - Transfected 29...
Haben Sie etwas anderes gesucht?