Coagulation Factor XIV/Protein C (N-Term) Antikörper

Details zu Produkt Nr. ABIN4264274, Anbieter: Anmelden zum Anzeigen
Antigen
Epitop
N-Term
2
1
Reaktivität
Human
26
1
Wirt
Kaninchen
23
4
Klonalität
Polyklonal
Konjugat
Unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
25
3
2
2
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to LEP(leptin) The peptide sequence was selected form the N terminal of LEP. Peptide sequence MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS.
Reinigung Immunogen affinity purified
Hintergrund Gene Symbol: LEP
Gen-ID 3952
UniProt P41159
Applikationshinweise Western Blot 0.2-1 μg/mL, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 μg/mLThis is a rabbit polyclonal antibody against LEP and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?