Factor XI Antikörper (Coagulation Factor XI) (C-Term)

Details for Product anti-F11 Antibody No. ABIN4264271, Anbieter: Anmelden zum Anzeigen
  • FXI
  • 1600027G01Rik
  • AI503996
  • Cf11
  • LRRGT00086
  • coagulation factor XI
  • F11
  • CpipJ_CPIJ000593
  • CpipJ_CPIJ001060
  • CpipJ_CPIJ002752
  • CpipJ_CPIJ003631
  • CpipJ_CPIJ004041
  • CpipJ_CPIJ004093
Dieser Factor XI Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to the C terminal of F11. Immunizing peptide sequence RHLCGGSIIGNQWILTAAHCFYGVESPKILRVYSGILNQSEIKEDTSFFG.
Reinigung Immunogen affinity purified
Andere Bezeichnung Coagulation Factor XI (F11 Antibody Abstract)
Hintergrund Gene Symbol: F11
Molekulargewicht Theoretical MW: 70 kDa
Gen-ID 2160
UniProt P03951
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against F11 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?