CNTNAP4 Antikörper (Contactin Associated Protein-Like 4) (N-Term)

Details for Product anti-CNTNAP4 Antibody No. ABIN4264207, Anbieter: Anmelden zum Anzeigen
  • cntnap4
  • CASPR4
  • Caspr4
  • E130114F09Rik
  • contactin associated protein-like 4
  • si:ch211-122m3.1
  • si:ch211-122m3.1
  • cntnap4
  • Cntnap4
Dieser CNTNAP4 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to CNTNAP4(contactin associated protein-like 4) The peptide sequence was selected from the N terminal of CNTNAP4. Peptide sequence KLPSTSTLVNLTLGSLLDDQHWHSVLIQRLGKQVNFTVDEHRHHFHARGE.
Reinigung Immunogen affinity purified
Andere Bezeichnung CNTNAP4 (CNTNAP4 Antibody Abstract)
Hintergrund Gene Symbol: CNTNAP4
Gen-ID 85445
UniProt Q9C0A0
Forschungsgebiet Neurology
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CNTNAP4 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.