CNTNAP4 Antikörper (Contactin Associated Protein-Like 4) (N-Term)

Details for Product anti-CNTNAP4 Antibody No. ABIN4264206, Anbieter: Anmelden zum Anzeigen
Antigen
  • CNTNAP4
  • CNTNAP5
  • cntnap4
  • CASPR4
  • Caspr4
  • E130114F09Rik
  • contactin associated protein-like 4
  • si:ch211-122m3.1
  • CNTNAP4
  • si:ch211-122m3.1
  • cntnap4
  • Cntnap4
Epitop
N-Term
18
16
16
4
2
2
2
2
2
1
Reaktivität
Human
47
5
2
2
2
2
2
2
1
Wirt
Kaninchen
44
5
Klonalität
Polyklonal
Konjugat
Dieser CNTNAP4 Antikörper ist unkonjugiert
4
4
4
4
4
4
Applikation
Western Blotting (WB)
48
35
4
2
2
2
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to SIGLEC12(sialic acid binding Ig-like lectin 12) The peptide sequence was selected form the N terminal of SIGLEC12. Peptide sequence GRFLLLGDPQTNNCSLSIRDARKGDSGKYYFQVERGSRKWNYIYDKLSVH.
Reinigung Immunogen affinity purified
Andere Bezeichnung CNTNAP4 (CNTNAP4 Antibody Abstract)
Hintergrund Gene Symbol: SIGLEC12
Gen-ID 89858
UniProt Q96PQ1
Applikationshinweise Western BlotThis is a rabbit polyclonal antibody against SIGLEC12 and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?