Ecto-NOX Disulfide-Thiol Exchanger 1 (ENOX1) Antikörper

Details zu Produkt Nr. ABIN4264197, Anbieter: Anmelden zum Anzeigen
  • CNOX
  • PIG38
  • bA64J21.1
  • cCNOX
  • B230207J08
  • D230005D02Rik
  • RGD1306118
  • ecto-NOX disulfide-thiol exchanger 1
  • enox1
  • ENOX1
  • Enox1
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to ENOX1(ecto-NOX disulfide-thiol exchanger 1) The peptide sequence was selected from the middle region of ENOX1. Peptide sequence QQLQFLQQTMQGMQQQLLTIQEELNNKKSELEQAKEEQSHTQALLKVLQE.
Reinigung Immunogen affinity purified
Andere Bezeichnung CNOX (ENOX1 Antibody Abstract)
Hintergrund Gene Symbol: ENOX1
Gen-ID 55068
UniProt Q8TC92
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against ENOX1 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?