CNOT8 Antikörper (CCR4-NOT Transcription Complex, Subunit 8) (N-Term)

Details for Product anti-CNOT8 Antibody No. ABIN4264195, Anbieter: Anmelden zum Anzeigen
Antigen
  • calif
  • pop2
  • zgc:63844
  • wu:fe49a05
  • caf1
  • hcaf1
  • CAF1
  • CALIF
  • Caf1b
  • POP2
  • hCAF1
  • 1500015I04Rik
  • 1810022F04Rik
  • AA536816
  • AU015770
  • AU043059
  • CCR4-NOT transcription complex, subunit 8
  • CCR4-NOT transcription complex subunit 8
  • Cnot8
  • CNOT8
  • cnot8
  • PAAG_04884
  • VDBG_08730
Epitop
N-Term
25
24
9
9
7
4
3
3
2
2
1
1
1
Reaktivität
Maus
88
29
26
5
5
5
5
5
2
2
2
2
1
Wirt
Kaninchen
85
6
Klonalität
Polyklonal
Konjugat
Dieser CNOT8 Antikörper ist unkonjugiert
6
6
6
5
5
5
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
72
43
17
15
13
9
5
4
3
2
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen The immunogen for this antibody is Cnot8 - N-terminal region. Peptide sequence VWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQL.
Reinigung Immunogen affinity purified
Andere Bezeichnung CNOT8 (CNOT8 Antibody Abstract)
Hintergrund Gene Symbol: CNOT8
Molekulargewicht Theoretical MW: 33 kDa
Gen-ID 9337
NCBI Accession NP_081225
Applikationshinweise Western Blot 1:1000The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.