CNNM4 Antikörper (Cyclin M4)

Details for Product anti-CNNM4 Antibody No. ABIN4264190, Anbieter: Anmelden zum Anzeigen
Antigen
  • DKFZp468E0110
  • ACDP4
  • 5430430O18Rik
  • Acdp4
  • cyclin M4
  • CNNM4
  • CpipJ_CPIJ006743
  • cnnm4
  • Cnnm4
Reaktivität
Human
46
5
2
2
2
2
2
2
1
1
1
1
Wirt
Kaninchen
46
Klonalität
Polyklonal
Konjugat
Dieser CNNM4 Antikörper ist unkonjugiert
4
4
4
4
4
4
Applikation
Western Blotting (WB)
43
30
16
6
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to C1GALT1(core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1) The peptide sequence was selected form the middle region of C1GALT1. Peptide sequence NVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNY
Reinigung Immunogen affinity purified
Andere Bezeichnung CNNM4 (CNNM4 Antibody Abstract)
Hintergrund Gene Symbol: C1GALT1
Gen-ID 56913
UniProt Q9NS00
Applikationshinweise Western Blot 0.2-1 μg/mLThis is a rabbit polyclonal antibody against C1GALT1 and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.