CNIH Antikörper (Cornichon Homolog (Drosophila)) (N-Term)

Details for Product anti-CNIH Antibody No. ABIN4264186, Anbieter: Anmelden zum Anzeigen
  • CNIH
  • CNIL
  • TGAM77
  • 0610007J15
  • cornichon family AMPA receptor auxiliary protein 1
  • cornichon homolog (Drosophila)
  • CNIH1
  • Cnih
  • CNIH
Ratte (Rattus)
Dieser CNIH Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to Cnih (cornichon homolog (Drosophila)) The peptide sequence was selected from the N terminal of Cnih. Peptide sequence AFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPL.
Reinigung Immunogen affinity purified
Andere Bezeichnung CNIH (CNIH Antibody Abstract)
Hintergrund Gene Symbol: CNIH
Molekulargewicht Theoretical MW: 15 kDa
Gen-ID 10175
UniProt B0BNA6
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against Cnih and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?