CMTM2 Antikörper (CKLF-Like MARVEL Transmembrane Domain Containing 2) (N-Term)

Details for Product anti-CMTM2 Antibody No. ABIN4264165, Anbieter: Anmelden zum Anzeigen
  • CKLF-like MARVEL transmembrane domain containing 2
  • CMTM2
Dieser CMTM2 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CMTM2(CKLF-like MARVEL transmembrane domain containing 2) The peptide sequence was selected from the N terminal of CMTM2. Peptide sequence DKPQKAVQDHKEPSDKPQKAVQPKHEVGTRRGCRRYRWELKDSNKEFWLL.
Reinigung Immunogen affinity purified
Andere Bezeichnung CMTM2 (CMTM2 Antibody Abstract)
Hintergrund Gene Symbol: CMTM2
Gen-ID 146225
UniProt Q8TAZ6
Forschungsgebiet Stem Cells
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CMTM2 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?