Camello-Like 2 (CML2) Antikörper

Details zu Produkt Nr. ABIN4264160, Anbieter: Anmelden zum Anzeigen
  • RGD1561619
  • camello-like 2
  • Cml2
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to NAT8B(N-acetyltransferase 8B (gene/pseudogene)) The peptide sequence was selected from the middle region of NAT8B. Peptide sequence SCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKA.
Reinigung Immunogen affinity purified
Andere Bezeichnung CML2
Hintergrund Gene Symbol: NAT8B
Gen-ID 51471
UniProt Q9UHF3
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against NAT8B and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.