ANTXR2 Antikörper (Anthrax Toxin Receptor 2) (N-Term)

Details for Product anti-ANTXR2 Antibody No. ABIN4264158, Anbieter: Anmelden zum Anzeigen
Antigen
  • ANTXR2
  • DKFZp459A152
  • 2310046B19Rik
  • AW561899
  • CMG-2
  • CMG2
  • cI-35
  • HFS
  • ISH
  • JHF
  • anthrax toxin receptor 2
  • ANTXR2
  • antxr2
  • Antxr2
Epitop
N-Term
5
4
4
4
4
2
1
1
1
1
1
1
Reaktivität
Maus
56
34
30
9
8
4
4
3
3
2
2
1
Wirt
Kaninchen
31
23
4
Klonalität
Polyklonal
Konjugat
Dieser ANTXR2 Antikörper ist unkonjugiert
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
38
20
13
10
7
4
2
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to Antxr2 (anthrax toxin receptor 2) The peptide sequence was selected from the N terminal of Antxr2. Peptide sequence GLVPSYAENEAKKSRSLGASVYCVGVLDFEQAQLERIADSKDQVFPVKGG.
Reinigung Immunogen affinity purified
Andere Bezeichnung CMG-2/ANTXR2 (ANTXR2 Antibody Abstract)
Hintergrund Gene Symbol: ANTXR2
Molekulargewicht Theoretical MW: 53 kDa
Gen-ID 118429
UniProt Q6DFX2
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against Antxr2 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?