Cytidine Monophosphate N-Acetylneuraminic Acid Synthetase (CMAS) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4264136, Anbieter: Anmelden zum Anzeigen
Antigen
  • CMAS
  • MGC126990
  • CSS
  • cmas
  • cmas1
  • si:dkey-183c2.1
  • wu:fj16c12
  • zgc:136241
  • AW208911
  • CMPNeu5Ac
  • D6Bwg0250e
  • cytidine monophosphate N-acetylneuraminic acid synthetase
  • cytidine monophosphate N-acetylneuraminic acid synthetase a
  • cytidine monophospho-N-acetylneuraminic acid synthetase
  • CMAS
  • cmas
  • LOC100225966
  • Cmas
  • cmasa
Epitop
N-Term
4
3
3
3
3
3
2
2
1
1
Reaktivität
Human
23
6
6
2
2
2
2
2
1
1
1
1
1
Wirt
Kaninchen
17
6
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
22
9
7
3
3
2
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to CMAS(cytidine monophosphate N-acetylneuraminic acid synthetase) The peptide sequence was selected from the N terminal of CMAS. Peptide sequence GRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAF.
Reinigung Immunogen affinity purified
Andere Bezeichnung CMAS (CMAS Antibody Abstract)
Hintergrund Gene Symbol: CMAS
Gen-ID 55907
UniProt Q8NFW8
Forschungsgebiet Signaling, Metabolism
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CMAS and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.