Clusterin-Like 1 (Retinal) (CLUL1) Antikörper

Details zu Produkt Nr. ABIN4264119, Anbieter: Anmelden zum Anzeigen
Antigen
  • RA337M
  • clusterin-like 1 (retinal)
  • CLUL1
  • Clul1
Reaktivität
Human
28
2
1
1
Wirt
Kaninchen
25
3
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
2
2
2
2
2
Applikation
Western Blotting (WB)
26
14
2
2
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to CLUL1 (clusterin-like 1 (retinal)) The peptide sequence was selected from the middle region of CLUL1)(50ug). Peptide sequence TEIIFNSIQVVPRIHEGNISKQDETMMTDLSILPSSNFTLKIPLEESAES.
Reinigung Immunogen affinity purified
Andere Bezeichnung Clusterin-Like 1/CLUL1
Hintergrund Gene Symbol: CLUL1
Gen-ID 27098
UniProt Q15846
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CLUL1 and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.