Ceroid-Lipofuscinosis, Neuronal 8 (Epilepsy, Progressive with Mental Retardation) (CLN8) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4263830, Anbieter: Anmelden zum Anzeigen
  • mnd
  • C8orf61
  • EPMR
  • CLN8, transmembrane ER and ERGIC protein
  • ceroid-lipofuscinosis, neuronal 8
  • CLN8
  • Cln8
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptide directed towards the N terminal of human CLN8. Peptide sequence VFGVQSTAAGLWALLGDPVLHADKARGQQNWCWFHITTATGFFCFENVAV.
Reinigung Immunogen affinity purified
Andere Bezeichnung CLN8 (CLN8 Antibody Abstract)
Hintergrund Gene Symbol: CLN8
Gen-ID 2055
NCBI Accession NP_061764
Forschungsgebiet Signaling, Metabolism
Pathways Regulation of Cell Size, Dicarboxylic Acid Transport
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against CLN8 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?