CLN3 Antikörper (Ceroid-Lipofuscinosis, Neuronal 3)

Details for Product anti-CLN3 Antibody No. ABIN4263826, Anbieter: Anmelden zum Anzeigen
Antigen
  • zgc:92244
  • GB12798
  • MGC80041
  • bts
  • AI323623
  • BTS
  • JNCL
  • ceroid-lipofuscinosis, neuronal 3
  • battenin
  • ceroid lipofuscinosis, neuronal 3, juvenile (Batten, Spielmeyer-Vogt disease)
  • cln3
  • PTRG_05620
  • CLN3
  • Cln3
Reaktivität
Human
36
25
23
Wirt
Kaninchen
32
4
Klonalität
Polyklonal
Konjugat
Dieser CLN3 Antikörper ist unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC)
23
13
11
8
4
3
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Immunogen This antibody was developed against a recombinant protein corresponding to amino acids:EEEAESAARQPLIRTEAPESKPGSSSSLSLRERWTVF
Isotyp IgG
Reinigung Immunogen affinity purified
Andere Bezeichnung CLN3 (CLN3 Antibody Abstract)
Hintergrund Gene Symbol: CLN3
Gen-ID 1201
Applikationshinweise Immunohistochemistry 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-CLN3 Antikörper (Ceroid-Lipofuscinosis, Neuronal 3) (ABIN4263826) Immunohistochemistry: CLN3 Antibody [NBP2-49391] - Staining of human smooth muscle sh...