CLIC6 Antikörper (Chloride Intracellular Channel 6)

Details for Product anti-CLIC6 Antibody No. ABIN4263817, Anbieter: Anmelden zum Anzeigen
  • CLIC6
  • CLIC1L
  • 5730466J16Rik
  • AL022908
  • AW045520
  • Clic6b
  • chloride intracellular channel 6
  • CLIC6
  • Clic6
Dieser CLIC6 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptide directed towards the middle region of human CLIC6. Peptide sequence RREDGEASEPRALGQEHDITLFVKAGYDGESIGNCPFSQRLFMILWLKGV.
Reinigung Immunogen affinity purified
Andere Bezeichnung CLIC6 (CLIC6 Antibody Abstract)
Hintergrund Gene Symbol: CLIC6
Gen-ID 54102
NCBI Accession NP_444507
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against CLIon Channel6 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?