CLIC2 Antikörper (Chloride Intracellular Channel 2)

Details for Product anti-CLIC2 Antibody No. ABIN4263814, Anbieter: Anmelden zum Anzeigen
Antigen
  • zgc:92762
  • CLIC2
  • CLIC2b
  • MRXS32
  • XAP121
  • chloride intracellular channel 2
  • clic2
  • CLIC2
  • LOC100229375
  • Clic2
Alternativen
anti-Human CLIC2 Antikörper für ELISA
Reaktivität
Human
41
20
17
4
3
3
3
2
2
2
Wirt
Kaninchen
32
9
Klonalität
Polyklonal
Konjugat
Dieser CLIC2 Antikörper ist unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
27
13
7
4
2
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptide directed towards the middle region of human CLIC2. Peptide sequence HLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYL.
Reinigung Protein A purified
Andere Bezeichnung CLIC2 (CLIC2 Antibody Abstract)
Hintergrund Gene Symbol: CLIC2
Gen-ID 1193
NCBI Accession NP_001280
Forschungsgebiet Signaling, Transporters, Metabolism
Pathways Negative Regulation of Transporter Activity
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against CLIon Channel2 and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.