CLIC2 Antikörper (Chloride Intracellular Channel 2)

Details for Product anti-CLIC2 Antibody No. ABIN4263814, Anbieter: Anmelden zum Anzeigen
  • zgc:92762
  • CLIC2
  • CLIC2b
  • MRXS32
  • XAP121
  • chloride intracellular channel 2
  • clic2
  • CLIC2
  • Clic2
Dieser CLIC2 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptide directed towards the middle region of human CLIC2. Peptide sequence HLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYL.
Reinigung Protein A purified
Andere Bezeichnung CLIC2 (CLIC2 Antibody Abstract)
Hintergrund Gene Symbol: CLIC2
Gen-ID 1193
NCBI Accession NP_001280
Forschungsgebiet Signaling, Transporters, Metabolism
Pathways Negative Regulation of Transporter Activity
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against CLIon Channel2 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?