CLIC2 Antikörper (Chloride Intracellular Channel 2) (C-Term)

Details for Product anti-CLIC2 Antibody No. ABIN4263813, Anbieter: Anmelden zum Anzeigen
  • zgc:92762
  • CLIC2
  • CLIC2b
  • MRXS32
  • XAP121
  • chloride intracellular channel 2
  • clic2
  • CLIC2
  • LOC100229375
  • Clic2
anti-Human CLIC2 Antikörper für ELISA
Dieser CLIC2 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren


Immunogen Synthetic peptide directed towards the C terminal of human CLIC2. Peptide sequence SAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSG.
Reinigung Protein A purified
Andere Bezeichnung CLIC2 (CLIC2 Antibody Abstract)
Hintergrund Gene Symbol: CLIC2
Gen-ID 1193
NCBI Accession NP_001280
Forschungsgebiet Signaling, Transporters, Metabolism
Pathways Negative Regulation of Transporter Activity
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against CLIon Channel2 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-CLIC2 Antikörper (Chloride Intracellular Channel 2) (C-Term) (ABIN4263813) Western Blot: CLIC2 Antibody [NBP1-80058] - HepG2 cell lysate, concentration 1.25ug/ml.