Calmegin Antikörper (CLGN)

Details for Product anti-CLGN Antibody No. ABIN4263810, Anbieter: Anmelden zum Anzeigen
  • canx
  • fj49d10
  • wu:fj24b04
  • wu:fj49d10
  • zgc:153946
  • CLGN
  • clgn
  • clnx
  • cnx
  • 4930459O04Rik
  • AI528775
  • Cln
  • calmegin
  • calnexin
  • CLGN
  • clgn
  • LOC100354203
  • canx-a
  • Clgn
Immunohistochemistry (IHC)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren


Immunogen This antibody was developed against a recombinant protein corresponding to amino acids:ESEPEEKSEEEIEIIEGQEESNQSNKSGSEDEMKEADESTGSGDGPIKSVRKR
Isotyp IgG
Reinigung Immunogen affinity purified
Andere Bezeichnung CLGN (CLGN Antibody Abstract)
Hintergrund Gene Symbol: CLGN
Gen-ID 1047
Applikationshinweise Immunohistochemistry 1:1000 - 1:2500For IHC-Paraffin HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Calmegin Antikörper (CLGN) (ABIN4263810) Immunohistochemistry: CLGN Antibody [NBP2-48915] - Staining of human testis shows str...