C-Type Lectin Domain Family 1, Member B (CLEC1B) Antikörper

Details zu Produkt Nr. ABIN4263692, Anbieter: Anmelden zum Anzeigen
Antigen
  • CLEC1B
  • RGD1563517
  • 1810061I13Rik
  • CLEC2
  • CLEC2B
  • PRO1384
  • QDED721
  • Clec-2
  • Clec2
  • C-type lectin domain family 1, member B
  • C-type lectin domain family 1, member b
  • CLEC1B
  • Clec1b
  • LOC100346882
Reaktivität
Maus
89
36
19
17
2
1
1
1
1
1
Wirt
Kaninchen
64
29
16
14
Klonalität
Polyklonal
Konjugat
Unkonjugiert
8
8
5
5
4
4
3
3
3
3
3
3
3
3
3
3
3
2
2
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
74
34
22
13
4
4
2
2
1
1
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen The immunogen for this antibody is Clec1b. Peptide sequence MQDEDGYITLNIKPRKQALSSAEPASSWWRVMALVLLISSMGLVVGLVAL.
Reinigung Immunogen affinity purified
Andere Bezeichnung CLEC-2/CLEC-1B (CLEC1B Antibody Abstract)
Hintergrund Gene Symbol: CLEC1B
Gen-ID 51266
NCBI Accession NP_064369
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against Clec1b and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?