Chromosome 14 Open Reading Frame 166 (C14ORF166) (C-Term) Antikörper

Details zu Produkt Nr. ABIN4263670, Anbieter: Anmelden zum Anzeigen
  • C14orf166
  • CLE7
  • CGI99
  • CLE
  • LCRP369
  • RLLM1
  • chromosome 5 C14orf166 homolog
  • RNA transcription, translation and transport factor S homeolog
  • RNA transcription, translation and transport factor
  • C5H14orf166
  • rtraf.S
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen The immunogen for this antibody is CLE7 C-terminal. Peptide sequence EKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADP.
Reinigung Immunogen affinity purified
Andere Bezeichnung CLE7 Homolog (C14orf166 Antibody Abstract)
Hintergrund Gene Symbol: C14ORF166
Molekulargewicht Theoretical MW: 28 kDa
Gen-ID 51637
NCBI Accession NP_080804
Applikationshinweise Western Blot 1:1000The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?