Chromosome 14 Open Reading Frame 166 (C14ORF166) (C-Term) Antikörper

Details zu Produkt Nr. ABIN4263670, Anbieter: Anmelden zum Anzeigen
Antigen
  • C14orf166
  • CLE7
  • CGI99
  • CLE
  • LCRP369
  • RLLM1
  • chromosome 5 open reading frame, human C14orf166
  • chromosome 14 open reading frame 166
  • C5H14ORF166
  • c14orf166
  • C14orf166
Epitop
C-Term
3
2
1
1
Reaktivität
Maus
63
27
27
5
5
5
5
5
3
3
2
2
1
Wirt
Kaninchen
33
31
Klonalität
Polyklonal
Konjugat
Unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
46
18
17
13
8
6
3
2
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen The immunogen for this antibody is CLE7 C-terminal. Peptide sequence EKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADP.
Reinigung Immunogen affinity purified
Andere Bezeichnung CLE7 Homolog (C14orf166 Antibody Abstract)
Hintergrund Gene Symbol: C14ORF166
Molekulargewicht Theoretical MW: 28 kDa
Gen-ID 51637
NCBI Accession NP_080804
Applikationshinweise Western Blot 1:1000The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.