Chloride Channel Ka (CLCNKA) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4263666, Anbieter: Anmelden zum Anzeigen
  • C75963
  • CLC-K1
  • Clcnk1
  • CLCK1
  • ClC-K1
  • hClC-Ka
  • chloride voltage-gated channel Ka
  • chloride channel protein ClC-Ka
  • chloride channel, voltage-sensitive Ka
  • LOC703259
  • LOC100456543
  • LOC100593875
  • Clcnka
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptide directed towards the N terminal of human CLCNKA. Peptide sequence MEELVGLREGFSGDPVTLQELWGPCPHIRRAIQGGLEWLKQKVFRLGEDW.
Reinigung Immunogen affinity purified
Andere Bezeichnung CLCNKA (CLCNKA Antibody Abstract)
Hintergrund Gene Symbol: CLCNKA
Gen-ID 1187
NCBI Accession NP_004061
Pathways Response to Water Deprivation
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against CLCNKA and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?