Chloride Channel 5 Antikörper (CLCN5)

Details for Product anti-CLCN5 Antibody No. ABIN4263664, Anbieter: Anmelden zum Anzeigen
  • CLCN3
  • CLCN5
  • clcn5-A
  • DKFZp469O2315
  • 5430408K11Rik
  • ClC-5
  • Clc5
  • D930009B12Rik
  • DXImx42e
  • Sfc13
  • T25545
  • CLC5
  • CLCK2
  • NPHL1
  • NPHL2
  • XLRH
  • XRN
  • hCIC-K2
  • CLCN4
  • Clcn5
  • chloride channel 5
  • chloride channel 5 (nephrolithiasis 2, X-linked, Dent disease)
  • chloride channel, voltage-sensitive 5
  • H(+)/Cl(-) exchange transporter 5-like
  • outwardly rectifying chloride channel
  • CLCN5
  • clcn5-A
  • clcn5
  • Clcn5
  • LOC100135502
  • CLC-5
Human, Maus, Ratte (Rattus)
Dieser Chloride Channel 5 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to Clcn5 (chloride channel 5) The peptide sequence was selected from the middle region of Clcn5. Peptide sequence LVVIMFELTGGLEYIVPLMAAAMTSKWVADALGREGIYDAHIRLNGYPFL.
Reinigung Immunogen affinity purified
Andere Bezeichnung CLCN5 (CLCN5 Antibody Abstract)
Hintergrund Gene Symbol: CLCN5
Molekulargewicht Theoretical MW: 83 kDa
Gen-ID 1184
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against Clcn5 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?