Chloride Channel 1, Skeletal Muscle (CLCN1) (C-Term) Antikörper

Details zu Produkt Nr. ABIN4263662, Anbieter: Anmelden zum Anzeigen
Antigen
  • CLCN1
  • si:dkey-14o18.5
  • Clc-1
  • Clc1
  • SMCC1
  • adr
  • mto
  • myotonia
  • nmf355
  • SMCC
  • CLC1
  • chloride channel 1, skeletal muscle
  • chloride channel 1, skeletal muscle (Thomsen disease, autosomal dominant)
  • chloride channel 1a
  • similar to chloride channel 1, skeletal muscle (Thomsen disease, autosomal dominant)
  • chloride channel 1
  • chloride channel, voltage-sensitive 1
  • CLCN1
  • clcn1a
  • Clcn1
Epitop
C-Term
8
5
1
Reaktivität
Maus, Ratte (Rattus)
19
19
15
2
2
2
1
1
1
Wirt
Kaninchen
27
Klonalität
Polyklonal
Applikation
Immunohistochemistry (IHC), Western Blotting (WB)
22
10
9
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to Clcn1 (chloride channel 1) The peptide sequence was selected from the C terminal of Clcn1. Peptide sequence SSIFQRLLHCLLGKAHSTKKKITQDSTDLVDNMSPEEIEAWEREQLSQPV.
Reinigung Immunogen affinity purified
Andere Bezeichnung CLCN1 (CLCN1 Antibody Abstract)
Hintergrund Gene Symbol: CLCN1
Molekulargewicht Theoretical MW: 110 kDa
Gen-ID 1180
Applikationshinweise Western Blot 1:100-1:2000, ImmunohistochemistryThis is a rabbit polyclonal antibody against Clcn1 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.