Claudin 9 (CLDN9) (C-Term) Antikörper

Details zu Produkt Nr. ABIN4263660, Anbieter: Anmelden zum Anzeigen
Antigen
  • CLDN9
  • nmf329
  • claudin 9
  • CLDN9
  • Cldn9
  • LOC100337855
Epitop
C-Term
7
Reaktivität
Human
18
13
13
5
4
2
2
2
1
1
Wirt
Kaninchen
16
1
1
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
13
6
2
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CLDN9 (claudin 9) The peptide sequence was selected from the C terminal of CLDN9. Peptide sequence WAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV.
Reinigung Protein A purified
Andere Bezeichnung Claudin-9 (CLDN9 Antibody Abstract)
Hintergrund Gene Symbol: CLDN9
Molekulargewicht Theoretical MW: 24 kDa
Gen-ID 9080
UniProt O95484
Pathways Cell-Cell Junction Organization, Hepatitis C
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CLDN9 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-Claudin 9 (CLDN9) (C-Term) antibody (ABIN4263660) Western Blot: Claudin-9 Antibody [NBP1-59156] - HepG2 cell lysate, concentration 2.0u...
Haben Sie etwas anderes gesucht?