Claudin 18 (CLDN18) Antikörper

Details zu Produkt Nr. ABIN4263654, Anbieter: Anmelden zum Anzeigen
Antigen
  • claudin-18
  • CLDN18
  • SFTA5
  • SFTPJ
  • claudin 18
  • cldn18
  • CLDN18
  • LOC100349260
  • Cldn18
Reaktivität
Human
58
26
26
5
5
5
5
3
3
2
1
Wirt
Kaninchen
58
1
Klonalität
Polyklonal
Konjugat
Unkonjugiert
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
44
21
18
13
8
6
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CLDN18(claudin 18) The peptide sequence was selected from the middle region of CLDN18. Peptide sequence YHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDY.
Reinigung Immunogen affinity purified
Andere Bezeichnung Claudin-18 (CLDN18 Antibody Abstract)
Hintergrund Gene Symbol: CLDN18
Gen-ID 51208
UniProt P56856
Pathways Cell-Cell Junction Organization, Hepatitis C
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CLDN18 and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?