Claudin 17 (CLDN17) Antikörper

Details zu Produkt Nr. ABIN4263653, Anbieter: Anmelden zum Anzeigen
Antigen
  • CLDN17
  • Claudin-17
  • zgc:173444
  • claudin 17
  • CLDN17
  • cldn17
  • LOC100354623
  • Cldn17
Reaktivität
Human
39
6
5
5
3
3
2
2
1
1
1
Wirt
Kaninchen
24
15
Klonalität
Polyklonal
Konjugat
Unkonjugiert
3
3
3
3
3
2
2
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC)
15
13
12
7
4
2
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids:CNRKKQGYRYPVPGYRVPHTDKRRNTTMLSKTSTSYV
Isotyp IgG
Reinigung Immunogen affinity purified
Andere Bezeichnung Claudin-17 (CLDN17 Antibody Abstract)
Hintergrund Gene Symbol: CLDN17
Gen-ID 26285
Pathways Cell-Cell Junction Organization, Hepatitis C
Applikationshinweise Immunohistochemistry 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Claudin 17 (CLDN17) antibody (ABIN4263653) Immunohistochemistry: Claudin-17 Antibody [NBP2-48838] - Staining of human oral mucos...
Haben Sie etwas anderes gesucht?