Claudin 17 (CLDN17) Antikörper

Details zu Produkt Nr. ABIN4263652, Anbieter: Anmelden zum Anzeigen
  • CLDN17
  • Claudin-17
  • zgc:173444
  • claudin 17
  • CLDN17
  • cldn17
  • LOC100354623
  • Cldn17
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CLDN17 (claudin 17) The peptide sequence was selected from the middle region of CLDN17. Peptide sequence KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA.
Reinigung Protein A purified
Andere Bezeichnung Claudin-17 (CLDN17 Antibody Abstract)
Hintergrund Gene Symbol: CLDN17
Gen-ID 26285
UniProt P56750
Pathways Cell-Cell Junction Organization, Hepatitis C
Applikationshinweise Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500This is a rabbit polyclonal antibody against CLDN17 and was validated on Western Blot and immunohistochemistry-paraffin

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Claudin 17 (CLDN17) antibody (ABIN4263652) Immunohistochemistry-Paraffin: Claudin 17 Antibody [NBP1-59155] - Human Spleen Tissue...
Western Blotting (WB) image for anti-Claudin 17 (CLDN17) antibody (ABIN4263652) Western Blot: Claudin 17 Antibody [NBP1-59155] - Titration: 2.0ug/ml Positive Control...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Claudin 17 (CLDN17) antibody (ABIN4263652) Immunohistochemistry-Paraffin: Claudin 17 Antibody [NBP1-59155] - Human Lung Alveolar...
Haben Sie etwas anderes gesucht?