Claudin 16 (CLDN16) (C-Term) Antikörper

Details zu Produkt Nr. ABIN4263650, Anbieter: Anmelden zum Anzeigen
Antigen
  • CLDN16
  • HOMG3
  • PCLN1
  • claudin-16
  • Pcln1
  • claudin 16
  • CLDN16
  • Cldn16
  • LOC100356384
Alternativen
anti-Human Claudin 16 Antikörper für ELISA
Epitop
C-Term
15
12
9
4
4
2
2
2
1
Reaktivität
Human
57
21
17
4
4
4
2
2
2
Wirt
Kaninchen
51
7
Klonalität
Polyklonal
Konjugat
Unkonjugiert
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
39
23
18
16
13
8
5
2
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to CLDN16 (claudin 16) The peptide sequence was selected from the C terminal of CLDN16. Peptide sequence FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA.
Reinigung Protein A purified
Andere Bezeichnung Claudin-16 (CLDN16 Antibody Abstract)
Hintergrund Gene Symbol: CLDN16
Gen-ID 10686
UniProt Q9Y5I7
Pathways Hepatitis C
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CLDN16 and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.