Claudin 15 (CLDN15) (C-Term) Antikörper

Details zu Produkt Nr. ABIN4263647, Anbieter: Anmelden zum Anzeigen
  • CLDN15
  • cldn15
  • cldn15l
  • zgc:63943
  • zgc:136755
  • 2210009B08Rik
  • BB107105
  • claudin 15
  • claudin 15a
  • claudin 15b
  • Cldn15
  • CLDN15
  • cldn15a
  • cldn15b
  • LOC100219596
  • LOC100357702
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CLDN15 (claudin 15) The peptide sequence was selected from the C terminal of CLDN15. Peptide sequence LCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV.
Reinigung Protein A purified
Andere Bezeichnung Claudin-15 (CLDN15 Antibody Abstract)
Hintergrund Gene Symbol: CLDN15
Gen-ID 24146
UniProt P56746
Pathways Cell-Cell Junction Organization, Hepatitis C
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CLDN15 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-Claudin 15 (CLDN15) (C-Term) antibody (ABIN4263647) Western Blot: Claudin-15 Antibody [NBP1-59149] - Titration: 5.0ug/ml Positive Control...
Haben Sie etwas anderes gesucht?