CMTM8 Antikörper (CKLF-Like MARVEL Transmembrane Domain Containing 8)

Details for Product anti-CMTM8 Antibody No. ABIN4263615, Anbieter: Anmelden zum Anzeigen
  • MGC82744
  • marveld1
  • CKLFSF8-V2
  • 2700018N07Rik
  • AA408515
  • Cklfsf8
  • CKLF-like MARVEL transmembrane domain containing 8
  • cmtm8
  • CMTM8
  • Cmtm8
Dieser CMTM8 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CMTM8(CKLF-like MARVEL transmembrane domain containing 8) The peptide sequence was selected from the middle region of CMTM8. Peptide sequence CFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGN.
Reinigung Immunogen affinity purified
Andere Bezeichnung Cklfsf8 (CMTM8 Antibody Abstract)
Hintergrund Gene Symbol: CMTM8
Gen-ID 152189
UniProt Q8IZV2
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CMTM8 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?