CMTM8 Antikörper (CKLF-Like MARVEL Transmembrane Domain Containing 8) (N-Term)

Details for Product anti-CMTM8 Antibody No. ABIN4263614, Anbieter: Anmelden zum Anzeigen
Antigen
  • MGC82744
  • marveld1
  • CKLFSF8
  • CKLFSF8-V2
  • 2700018N07Rik
  • AA408515
  • Cklfsf8
  • CKLF-like MARVEL transmembrane domain containing 8
  • cmtm8
  • CMTM8
  • Cmtm8
Epitop
N-Term
2
1
1
1
Reaktivität
Human
30
20
19
4
2
2
2
2
1
Wirt
Kaninchen
30
Klonalität
Polyklonal
Konjugat
Dieser CMTM8 Antikörper ist unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
13
13
6
6
5
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to LAYN(layilin) The peptide sequence was selected form the N terminal of LAYN. Peptide sequence CYKVIYFHDTSRRLNFEEAKEACRRDGGQLVSIESEDEQKLIEKFIENLL.
Reinigung Immunogen affinity purified
Andere Bezeichnung Cklfsf8 (CMTM8 Antibody Abstract)
Hintergrund Gene Symbol: LAYN
Gen-ID 143903
Applikationshinweise Optimal working dilution should be determined by the investigator.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?