CKII alpha Prime Polypeptide (C-Term), (Isoform alpha') Antikörper

Details zu Produkt Nr. ABIN4263610, Anbieter: Anmelden zum Anzeigen
C-Term, Isoform alpha'
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CSNK2A2(casein kinase 2, alpha prime polypeptide) The peptide sequence was selected from the C terminal of CSNK2A2. Peptide sequence GTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD.
Spezifität This product is specific to Subunit or Isoform: alpha'.
Reinigung Immunogen affinity purified
Hintergrund Gene Symbol: CSNK2A2
Gen-ID 1459
UniProt P19784
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CSNK2A2 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?