Casein Kinase 1, gamma 3 (CSNK1G3) Antikörper

Details zu Produkt Nr. ABIN4263606, Anbieter: Anmelden zum Anzeigen
Antigen
  • CKI-gamma 3
  • CSNK1G3L
  • 3300002K07Rik
  • C330049O21Rik
  • casein kinase 1, gamma 3
  • CSNK1G3
  • csnk1g3
  • Csnk1g3
Alternativen
anti-Human Casein Kinase 1, gamma 3 Antikörper für ELISA
Reaktivität
Human
46
42
24
5
4
2
2
2
2
2
1
1
1
1
Wirt
Kaninchen
63
Klonalität
Polyklonal
Konjugat
Unkonjugiert
5
5
4
4
4
3
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
47
29
28
13
10
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to CSNK1G3(casein kinase 1, gamma 3) The peptide sequence was selected from the middle region of CSNK1G3. Peptide sequence LEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP.
Reinigung Immunogen affinity purified
Andere Bezeichnung CKI gamma 3 (CSNK1G3 Antibody Abstract)
Hintergrund Gene Symbol: CSNK1G3
Gen-ID 1456
UniProt Q9Y6M4
Pathways Hedgehog Signalweg
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CSNK1G3 and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.