CITED4 Antikörper (Cbp/p300-Interacting Transactivator, with Glu/Asp-Rich Carboxy-terminal Domain, 4) (N-Term)

Details for Product anti-CITED4 Antibody No. ABIN4263587, Anbieter: Anmelden zum Anzeigen
Antigen
  • CITED4
  • MRG-2
  • Mrg2
  • CITED3
  • cCITED3
  • similar to Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal
  • Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 4
  • CITED4
  • LOC100337814
  • cited4
  • Cited4
Epitop
N-Term
26
3
2
1
1
1
1
1
Reaktivität
Maus
30
7
5
Wirt
Kaninchen
30
8
Klonalität
Polyklonal
Konjugat
Dieser CITED4 Antikörper ist unkonjugiert
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
34
28
24
19
15
15
10
2
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Immunogen Synthetic peptide directed towards the N terminal of mouse CITED4. Peptide sequence PYAGPGMDSGLRPRGAPLGPPPPPGTLAYGSFGSPVSFQPFPVSQSPGAG.
Reinigung Protein A purified
Andere Bezeichnung CITED4 (CITED4 Antibody Abstract)
Hintergrund Gene Symbol: CITED4
Molekulargewicht Theoretical MW: 20 kDa
Gen-ID 163732
NCBI Accession NP_062509
Forschungsgebiet Transcription Factors, Cancer
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against CITED4 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-CITED4 Antikörper (Cbp/p300-Interacting Transactivator, with Glu/Asp-Rich Carboxy-terminal Domain, 4) (N-Term) (ABIN4263587) Western Blot: CITED4 Antibody [NBP1-80241] - Titration: 1.25ug/ml, Positive Control: ...