CISH Antikörper (Cytokine Inducible SH2-Containing Protein) (N-Term)

Details for Product anti-CISH Antibody No. ABIN4263566, Anbieter: Anmelden zum Anzeigen
Antigen
  • CISH
  • cis
  • cish.a
  • ptk9l
  • twf1l
  • wu:fk57g04
  • zgc:154062
  • zgc:91817
  • g18
  • socs
  • cis-1
  • cish
  • BACTS2
  • CIS
  • CIS-1
  • G18
  • SOCS
  • AI385595
  • CIS1
  • Cis
  • F17
  • F23
  • cytokine inducible SH2-containing protein
  • cytokine-inducible SH2-containing protein
  • Cytokine-inducible SH2-containing protein
  • CISH
  • cish
  • Cish
Alternativen
anti-Maus CISH Antikörper für ELISA
Epitop
N-Term
7
5
3
3
2
1
1
1
1
Reaktivität
Maus
28
15
15
4
3
3
3
2
2
2
1
Wirt
Kaninchen
28
2
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
27
10
9
9
7
3
2
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptide directed towards the N terminal of human CishThe immunogen for this antibody is Cish. Peptide sequence RESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPT.
Reinigung Immunogen affinity purified
Andere Bezeichnung CISH/CIS-1 (CISH Antibody Abstract)
Hintergrund Gene Symbol: CISH
Molekulargewicht Theoretical MW: 28 kDa
Gen-ID 1154
NCBI Accession NP_034025
Pathways JAK-STAT Signalweg, Response to Growth Hormone Stimulus
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against Cish and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.