SH3-Domain Kinase Binding Protein 1 (SH3KBP1) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4263544, Anbieter: Anmelden zum Anzeigen
Antigen
  • CD2BP3
  • CIN85
  • GIG10
  • HSB-1
  • HSB1
  • MIG18
  • 1200007H22Rik
  • 1700125L08Rik
  • 5830464D22Rik
  • AI447724
  • IN85
  • Ruk
  • Seta
  • SH3-domain kinase binding protein 1
  • SH3KBP1
  • sh3kbp1
  • Sh3kbp1
Epitop
N-Term
5
4
1
1
1
1
1
1
1
Reaktivität
Human
39
32
30
6
5
5
4
3
2
1
1
1
1
Wirt
Kaninchen
30
6
5
Klonalität
Polyklonal
Konjugat
Unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Western Blotting (WB)
22
14
12
9
4
4
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to SH3KBP1 (SH3-domain kinase binding protein 1) The peptide sequence was selected from the N terminal of SH3KBP1. Peptide sequence TGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKS.
Reinigung Immunogen affinity purified
Andere Bezeichnung CIN85/SH3KBP1 (SH3KBP1 Antibody Abstract)
Hintergrund Gene Symbol: SH3KBP1
Gen-ID 30011
UniProt Q5JPT5
Pathways EGFR Signaling Pathway, EGFR Downregulation
Applikationshinweise Western Blot 1:100-1:2000, ImmunohistochemistryThis is a rabbit polyclonal antibody against SH3KBP1 and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?