Calcium and Integrin Binding Protein 3 (CIB3) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4263520, Anbieter: Anmelden zum Anzeigen
  • KIP3
  • C730014M21Rik
  • Gm1107
  • calcium and integrin binding family member 3
  • Cib3
  • cib3
  • CIB3
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to CIB3(calcium and integrin binding family member 3) The peptide sequence was selected from the N terminal of CIB3. Peptide sequence QDLAPQLVPLDYTTCPDVKVPYELIGSMPELKDNPFRQRIAQVFSEDGDG.
Reinigung Immunogen affinity purified
Andere Bezeichnung CIB3 (CIB3 Antibody Abstract)
Hintergrund Gene Symbol: CIB3
Molekulargewicht Theoretical MW: 22 kDa
Gen-ID 117286
UniProt Q96Q77
Forschungsgebiet Signaling
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CIB3 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.