Mast Cell Protease 1-Like 1 (MCPT1L1) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4263493, Anbieter: Anmelden zum Anzeigen
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to CTRL(chymotrypsin-like) The peptide sequence was selected from the N terminal of CTRL. Peptide sequence SQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNS.
Reinigung Immunogen affinity purified
Andere Bezeichnung Chymotrypsin-Like Protease
Hintergrund Gene Symbol: CTRL
Molekulargewicht Theoretical MW: 28 kDa
Gen-ID 1506
UniProt P40313
Forschungsgebiet Proteolysis / Ubiquitin
Applikationshinweise Western Blot 0.2-1 μg/mLThis is a rabbit polyclonal antibody against CTRL and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.