High Affinity Choline Transporter (ChT) Antikörper

Details zu Produkt Nr. ABIN4263464, Anbieter: Anmelden zum Anzeigen
  • CHT1
  • CHT
  • HMN7A
  • hCHT
  • Cht1
  • CHOT1
  • CRT
  • CT1
  • solute carrier family 5 (choline transporter), member 7
  • solute carrier family 5 (sodium/choline cotransporter), member 7
  • solute carrier family 6 (neurotransmitter transporter), member 8
  • V-set and immunoglobulin domain containing 1
  • SLC5A7
  • Slc5a7
  • Slc6a8
  • VSIG1
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to SLC5A7(solute carrier family 5 (choline transporter), member 7) The peptide sequence was selected from the middle region of SLC5A7. Peptide sequence DDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAV.
Reinigung Immunogen affinity purified
Andere Bezeichnung CHT1 (ChT Antibody Abstract)
Hintergrund Gene Symbol: SLC5A7
Molekulargewicht Theoretical MW: 63 kDa
Gen-ID 60482
UniProt Q9GZV3
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against SLC5A7 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.