Carbohydrate (N-Acetylgalactosamine 4-0) Sulfotransferase 14 (CHST14) Antikörper

Details zu Produkt Nr. ABIN4263462, Anbieter: Anmelden zum Anzeigen
  • ATCS
  • D4ST1
  • HNK1ST
  • 2600016L03Rik
  • D4ST-1
  • D4st1
  • d4st1
  • MGC136487
  • wu:fc04a01
  • zgc:136487
  • carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14
  • CHST14
  • Chst14
  • chst14
anti-Human Carbohydrate (N-Acetylgalactosamine 4-0) Sulfotransferase 14 Antikörper für ELISA
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to CHST14(carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14) The peptide sequence was selected from the middle region of CHST14. Peptide sequence REYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHW
Reinigung Immunogen affinity purified
Andere Bezeichnung CHST14 (CHST14 Antibody Abstract)
Hintergrund Gene Symbol: CHST14
Molekulargewicht Theoretical MW: 35 kDa
Gen-ID 113189
Pathways Glycosaminoglycan Metabolic Process
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CHST14 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.