CHRNA7 (Cholinergic Receptor, Nicotinic, alpha 7, Exons 5-10) and FAM7A (Family with Sequence Similarity 7A, Exons A-E) Fusion (CHRFAM7A) Antikörper

Details zu Produkt Nr. ABIN4263433, Anbieter: Anmelden zum Anzeigen
  • CHRNA7
  • CHRNA7-DR1
  • D-10
  • CHRNA7 (cholinergic receptor, nicotinic, alpha 7, exons 5-10) and FAM7A (family with sequence similarity 7A, exons A-E) fusion
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptide directed towards the middle region of human CHRFAM7A. Peptide Sequence: QRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRM
Reinigung Immunogen affinity purified
Andere Bezeichnung CHRFAM7A (CHRFAM7A Antibody Abstract)
Hintergrund Gene Symbol: CHRFAM7A
Gen-ID 89832
NCBI Accession NP_683709
Forschungsgebiet Neurology
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against CHRFAM7A and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?