CHRAC1 Antikörper (Chromatin Accessibility Complex 1) (N-Term)

Details for Product anti-CHRAC1 Antibody No. ABIN4263425, Anbieter: Anmelden zum Anzeigen
Antigen
  • chrac1
  • CHRAC1
  • CHARC1
  • CHARC15
  • CHRAC-1
  • CHRAC-15
  • CHRAC15
  • YCL1
  • 2410152E03Rik
  • 2810406L04Rik
  • chromatin accessibility complex 1
  • TEgg136e08.1
  • CHRAC1
  • Chrac1
Epitop
N-Term
6
3
3
3
3
2
2
2
2
1
1
Reaktivität
Human
42
16
12
5
4
3
3
2
1
1
1
Wirt
Kaninchen
27
15
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
33
17
11
5
3
2
2
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptide directed towards the N terminal of human CHRAC1. Peptide sequence SINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSE.
Reinigung Immunogen affinity purified
Andere Bezeichnung CHRAC1 (CHRAC1 Antibody Abstract)
Hintergrund Gene Symbol: CHRAC1
Molekulargewicht Theoretical MW: 15 kDa
Gen-ID 54108
NCBI Accession NP_059140
Forschungsgebiet Chromatin Binding Proteins, Transcription Factors, Chromatin and Nuclear Signaling
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against CHRAC1 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?