CHODL Antikörper (Chondrolectin) (C-Term)

Details for Product anti-CHODL Antibody No. ABIN4263288, Anbieter: Anmelden zum Anzeigen
Antigen
  • CHODL
  • zgc:110088
  • C21orf68
  • MT75
  • 3110074E07Rik
  • PRED12
  • chondrolectin
  • CHODL
  • chodl
  • LOC100223351
  • Chodl
Epitop
C-Term
10
4
2
2
2
1
1
1
1
Reaktivität
Maus
29
9
5
3
3
3
2
2
1
Wirt
Kaninchen
21
10
Klonalität
Polyklonal
Konjugat
Dieser CHODL Antikörper ist unkonjugiert
2
2
2
2
2
2
2
Applikation
Western Blotting (WB)
17
15
8
5
3
2
2
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptide directed towards the C terminal of human ChodlThe immunogen for this antibody is Chodl. Peptide sequence YLYQWNDDRCNMKHNYICKYEPEIHPTEPAEKPYLTNQPEETHENVVVTE.
Reinigung Immunogen affinity purified
Andere Bezeichnung Chondrolectin (CHODL Antibody Abstract)
Hintergrund Gene Symbol: CHODL
Molekulargewicht Theoretical MW: 30 kDa
Gen-ID 140578
NCBI Accession NP_624360
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against Chodl and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?